Anti CARD10 pAb (ATL-HPA055612)

Atlas Antibodies

SKU: ATL-HPA055612-25

• 

Protein Description: caspase recruitment domain family, member 10
Gene Name: CARD10
Alternative Gene Name: BIMP1, CARMA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033170: 89%, ENSRNOG00000008401: 87%
Entrez Gene ID: 29775
Uniprot ID: Q9BWT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPF
• Gene Sequence: LTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPF
• Gene ID - Mouse: ENSMUSG00000033170
• Gene ID - Rat: ENSRNOG00000008401
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.