Anti CAPZA3 pAb (ATL-HPA038688 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038688-25

Protein Description: capping protein (actin filament) muscle Z-line, alpha 3
Gene Name: CAPZA3
Alternative Gene Name: CAPPA3, Gsg3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041791: 90%, ENSRNOG00000008727: 90%
Entrez Gene ID: 93661
Uniprot ID: Q96KX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN
• Gene Sequence: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN
• Gene ID - Mouse: ENSMUSG00000041791
• Gene ID - Rat: ENSRNOG00000008727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.