Anti CAP2 pAb (ATL-HPA050530 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050530-25

Protein Description: CAP, adenylate cyclase-associated protein, 2 (yeast)
Gene Name: CAP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021373: 88%, ENSRNOG00000043350: 85%
Entrez Gene ID: 10486
Uniprot ID: P40123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT
• Gene Sequence: PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT
• Gene ID - Mouse: ENSMUSG00000021373
• Gene ID - Rat: ENSRNOG00000043350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.