Anti CAND1 pAb (ATL-HPA055748 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA055748-100

Protein Description: cullin-associated and neddylation-dissociated 1
Gene Name: CAND1
Alternative Gene Name: DKFZp434M1414, KIAA0829, TIP120, TIP120A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020114: 100%, ENSRNOG00000007834: 100%
Entrez Gene ID: 55832
Uniprot ID: Q86VP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT
• Gene Sequence: DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT
• Gene ID - Mouse: ENSMUSG00000020114
• Gene ID - Rat: ENSRNOG00000007834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.