Anti CALR3 pAb (ATL-HPA043355 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043355-25

• 

Protein Description: calreticulin 3
Gene Name: CALR3
Alternative Gene Name: CRT2, CT93, FLJ25355, MGC26577
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019732: 78%, ENSRNOG00000013260: 76%
Entrez Gene ID: 125972
Uniprot ID: Q96L12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN
• Gene Sequence: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN
• Gene ID - Mouse: ENSMUSG00000019732
• Gene ID - Rat: ENSRNOG00000013260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.