Anti CABYR pAb (ATL-HPA040703 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040703-25

Protein Description: calcium binding tyrosine-(Y)-phosphorylation regulated
Gene Name: CABYR
Alternative Gene Name: CBP86, CT88, FSP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024430: 55%, ENSRNOG00000047436: 56%
Entrez Gene ID: 26256
Uniprot ID: O75952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY
• Gene Sequence: GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY
• Gene ID - Mouse: ENSMUSG00000024430
• Gene ID - Rat: ENSRNOG00000047436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.