Anti CABP7 pAb (ATL-HPA016439 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA016439-25

• 
• 

Protein Description: calcium binding protein 7
Gene Name: CABP7
Alternative Gene Name: MGC57793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009075: 100%, ENSRNOG00000057703: 100%
Entrez Gene ID: 164633
Uniprot ID: Q86V35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTC
• Gene Sequence: LEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTC
• Gene ID - Mouse: ENSMUSG00000009075
• Gene ID - Rat: ENSRNOG00000057703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.