Anti CAAP1 pAb (ATL-HPA020404 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020404-25

• 
• 

Protein Description: caspase activity and apoptosis inhibitor 1
Gene Name: CAAP1
Alternative Gene Name: C9orf82, CAAP, FLJ13657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028578: 86%, ENSRNOG00000007299: 83%
Entrez Gene ID: 79886
Uniprot ID: Q9H8G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNEEAAAPEAPENTVQSEAGQIDDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKALMKAGDI
• Gene Sequence: CNEEAAAPEAPENTVQSEAGQIDDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKALMKAGDI
• Gene ID - Mouse: ENSMUSG00000028578
• Gene ID - Rat: ENSRNOG00000007299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.