Anti CA4 pAb (ATL-HPA017258 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017258-25

• 

Protein Description: carbonic anhydrase IV
Gene Name: CA4
Alternative Gene Name: CAIV, Car4, RP17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000805: 61%, ENSRNOG00000002916: 64%
Entrez Gene ID: 762
Uniprot ID: P22748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGA
• Gene Sequence: GTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGA
• Gene ID - Mouse: ENSMUSG00000000805
• Gene ID - Rat: ENSRNOG00000002916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.