Anti C9orf66 pAb (ATL-HPA035652 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035652-25

Protein Description: chromosome 9 open reading frame 66
Gene Name: C9orf66
Alternative Gene Name: FLJ31158
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061028: 34%, ENSRNOG00000046000: 35%
Entrez Gene ID: 157983
Uniprot ID: Q5T8R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAPPPQPREPGA
• Gene Sequence: RPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAPPPQPREPGA
• Gene ID - Mouse: ENSMUSG00000061028
• Gene ID - Rat: ENSRNOG00000046000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.