Anti C9orf116 pAb (ATL-HPA065287)

Atlas Antibodies

Catalog No.: ATL-HPA065287-25

Protein Description: chromosome 9 open reading frame 116
Gene Name: C9orf116
Alternative Gene Name: MGC29761, PIERCE1, RbEST47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026831: 58%, ENSRNOG00000010152: 70%
Entrez Gene ID: 138162
Uniprot ID: Q5BN46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN
• Gene Sequence: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN
• Gene ID - Mouse: ENSMUSG00000026831
• Gene ID - Rat: ENSRNOG00000010152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.