Anti C6orf58 pAb (ATL-HPA041449 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041449-25

• 

Protein Description: chromosome 6 open reading frame 58
Gene Name: C6orf58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015519: 62%, ENSRNOG00000012581: 61%
Entrez Gene ID: 352999
Uniprot ID: Q6P5S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISVDSWWADLNYFLSSLPFLAAVDSGVMGISSDQVRLLPPPKNERKFCYDVSSCRSSFPETMNKWNTFYQYLQS
• Gene Sequence: ISVDSWWADLNYFLSSLPFLAAVDSGVMGISSDQVRLLPPPKNERKFCYDVSSCRSSFPETMNKWNTFYQYLQS
• Gene ID - Mouse: ENSMUSG00000015519
• Gene ID - Rat: ENSRNOG00000012581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.