Anti C6orf163 pAb (ATL-HPA052927)

Atlas Antibodies

Catalog No.: ATL-HPA052927-25

Protein Description: chromosome 6 open reading frame 163
Gene Name: C6orf163
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071015: 66%, ENSRNOG00000009178: 71%
Entrez Gene ID: 206412
Uniprot ID: Q5TEZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEVTAKTKTEMYQNMDDEMKREHLAAEQRMVHRIQRIMMECHREKVEAVEKARAEERHIAQEAIQAQKSKAVEEIVNTGV
• Gene Sequence: QEVTAKTKTEMYQNMDDEMKREHLAAEQRMVHRIQRIMMECHREKVEAVEKARAEERHIAQEAIQAQKSKAVEEIVNTGV
• Gene ID - Mouse: ENSMUSG00000071015
• Gene ID - Rat: ENSRNOG00000009178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.