Anti C6orf118 pAb (ATL-HPA029789)

Atlas Antibodies

SKU: ATL-HPA029789-25

• 

Protein Description: chromosome 6 open reading frame 118
Gene Name: C6orf118
Alternative Gene Name: bA85G2.1, MGC23884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023873: 56%, ENSRNOG00000011243: 53%
Entrez Gene ID: 168090
Uniprot ID: Q5T5N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLCNLKKLLNRLQKDHREDVYLYISGHLNPNKLYQPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVPSEAQDTPLFRYLN
• Gene Sequence: TLCNLKKLLNRLQKDHREDVYLYISGHLNPNKLYQPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVPSEAQDTPLFRYLN
• Gene ID - Mouse: ENSMUSG00000023873
• Gene ID - Rat: ENSRNOG00000011243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.