Anti C5orf51 pAb (ATL-HPA043779)

Atlas Antibodies

Catalog No.: ATL-HPA043779-25

Protein Description: chromosome 5 open reading frame 51
Gene Name: C5orf51
Alternative Gene Name: LOC285636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041935: 83%, ENSRNOG00000050792: 23%
Entrez Gene ID: 285636
Uniprot ID: A6NDU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
• Gene Sequence: IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
• Gene ID - Mouse: ENSMUSG00000041935
• Gene ID - Rat: ENSRNOG00000050792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.