Anti C2orf66 pAb (ATL-HPA020869)

Atlas Antibodies

SKU: ATL-HPA020869-25

• 

Protein Description: chromosome 2 open reading frame 66
Gene Name: C2orf66
Alternative Gene Name: UNQ6411
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024513: 24%, ENSRNOG00000010637: 25%
Entrez Gene ID: 401027
Uniprot ID: Q6UXQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG
• Gene Sequence: TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG
• Gene ID - Mouse: ENSMUSG00000024513
• Gene ID - Rat: ENSRNOG00000010637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.