Anti C2orf49 pAb (ATL-HPA060814)

Atlas Antibodies

SKU: ATL-HPA060814-25

• 

Protein Description: chromosome 2 open reading frame 49
Gene Name: C2orf49
Alternative Gene Name: asw, MGC5509
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010290: 76%, ENSRNOG00000016447: 78%
Entrez Gene ID: 79074
Uniprot ID: Q9BVC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHRKSPSGPVKSPPLSPVGT
• Gene Sequence: GSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHRKSPSGPVKSPPLSPVGT
• Gene ID - Mouse: ENSMUSG00000010290
• Gene ID - Rat: ENSRNOG00000016447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.