Anti C20orf144 pAb (ATL-HPA019029 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019029-25

• 

Protein Description: chromosome 20 open reading frame 144
Gene Name: C20orf144
Alternative Gene Name: bclt, dJ63M2.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038523: 46%, ENSRNOG00000016583: 45%
Entrez Gene ID: 128864
Uniprot ID: Q9BQM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGAGLGS
• Gene Sequence: MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGAGLGS
• Gene ID - Mouse: ENSMUSG00000038523
• Gene ID - Rat: ENSRNOG00000016583
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.