Anti C1QTNF6 pAb (ATL-HPA002042 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002042-25

• 
• 
• 

Protein Description: C1q and tumor necrosis factor related protein 6
Gene Name: C1QTNF6
Alternative Gene Name: CTRP6, ZACRP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022440: 63%, ENSRNOG00000007300: 66%
Entrez Gene ID: 114904
Uniprot ID: Q9BXI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLR
• Gene Sequence: CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLR
• Gene ID - Mouse: ENSMUSG00000022440
• Gene ID - Rat: ENSRNOG00000007300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C1QTNF6 pAb (ATL-HPA002042 w/enhanced validation) – 1 Found

Iwata, Yoshinori; Yasufuku, Itaru; Saigo, Chiemi; Kito, Yusuke; Takeuchi, Tamotsu; Yoshida, Kazuhiro. Anti-fibrotic properties of an adiponectin paralog protein, C1q/TNF-related protein 6 (CTRP6), in diffuse gastric adenocarcinoma. Journal Of Cancer. 12(4):1161-1168.