Anti C1orf56 pAb (ATL-HPA037430 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037430-25

Protein Description: chromosome 1 open reading frame 56
Gene Name: C1orf56
Alternative Gene Name: FLJ20519, MENT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068860: 59%, ENSRNOG00000021656: 62%
Entrez Gene ID: 54964
Uniprot ID: Q9BUN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSLPPASPCPALAFWKRVRIG
• Gene Sequence: HKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSLPPASPCPALAFWKRVRIG
• Gene ID - Mouse: ENSMUSG00000068860
• Gene ID - Rat: ENSRNOG00000021656
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.