Anti C19orf57 pAb (ATL-HPA044012 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044012-25

• 

Protein Description: chromosome 19 open reading frame 57
Gene Name: C19orf57
Alternative Gene Name: MGC11271
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008129: 44%, ENSRNOG00000025796: 47%
Entrez Gene ID: 79173
Uniprot ID: Q0VDD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQIQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEAFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL
• Gene Sequence: SQIQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEAFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL
• Gene ID - Mouse: ENSMUSG00000008129
• Gene ID - Rat: ENSRNOG00000025796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.