Anti C19orf44 pAb (ATL-HPA041683)

Atlas Antibodies

SKU: ATL-HPA041683-25

• 

Protein Description: chromosome 19 open reading frame 44
Gene Name: C19orf44
Alternative Gene Name: FLJ21742
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052794: 53%, ENSRNOG00000023700: 54%
Entrez Gene ID: 84167
Uniprot ID: Q9H6X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRNLTKIAPGHSRFLKRNQTLDEKHLLLKENPVLGSGPRLASCRPPTTASRIRANAALMKLAQLETRIMNRKLQRNLSDTESDSMT
• Gene Sequence: SRNLTKIAPGHSRFLKRNQTLDEKHLLLKENPVLGSGPRLASCRPPTTASRIRANAALMKLAQLETRIMNRKLQRNLSDTESDSMT
• Gene ID - Mouse: ENSMUSG00000052794
• Gene ID - Rat: ENSRNOG00000023700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.