Anti C17ORF49 pAb (ATL-HPA024457)

Atlas Antibodies

Catalog No.: ATL-HPA024457-25

Protein Description: chromosome 17 open reading frame 49
Gene Name: C17ORF49
Alternative Gene Name: C17orf49, BAP18, HEPIS, MGC49942
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020831: 91%, ENSRNOG00000018829: 92%
Entrez Gene ID: 124944
Uniprot ID: Q8IXM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFD
• Gene Sequence: ESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFD
• Gene ID - Mouse: ENSMUSG00000020831
• Gene ID - Rat: ENSRNOG00000018829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.