Anti C16orf58 pAb (ATL-HPA024406 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024406-25

• 
• 
• 

Protein Description: chromosome 16 open reading frame 58
Gene Name: C16orf58
Alternative Gene Name: FLJ13868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030780: 75%, ENSRNOG00000020144: 80%
Entrez Gene ID: 64755
Uniprot ID: Q96GQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RALVMETLNEGRLRLVLKHYLQRGEVLDPTAANRMEPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEGHQESYLLCWDQSQNQVQVVLNQKAGPKTILRA
• Gene Sequence: RALVMETLNEGRLRLVLKHYLQRGEVLDPTAANRMEPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEGHQESYLLCWDQSQNQVQVVLNQKAGPKTILRA
• Gene ID - Mouse: ENSMUSG00000030780
• Gene ID - Rat: ENSRNOG00000020144
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.