Anti C12orf57 pAb (ATL-HPA046182)

Atlas Antibodies

Catalog No.: ATL-HPA046182-25

Protein Description: chromosome 12 open reading frame 57
Gene Name: C12orf57
Alternative Gene Name: C10, GRCC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072772: 98%, ENSRNOG00000050660: 98%
Entrez Gene ID: 113246
Uniprot ID: Q99622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQ
• Gene Sequence: MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQ
• Gene ID - Mouse: ENSMUSG00000072772
• Gene ID - Rat: ENSRNOG00000050660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.