Anti C12orf56 pAb (ATL-HPA056986 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA056986-25

Protein Description: chromosome 12 open reading frame 56
Gene Name: C12orf56
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047642: 51%, ENSRNOG00000023824: 50%
Entrez Gene ID: 115749
Uniprot ID: Q8IXR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS
• Gene Sequence: RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS
• Gene ID - Mouse: ENSMUSG00000047642
• Gene ID - Rat: ENSRNOG00000023824
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.