Anti C11orf96 pAb (ATL-HPA038843)

Atlas Antibodies

SKU: ATL-HPA038843-25

• 
• 

Protein Description: chromosome 11 open reading frame 96
Gene Name: C11orf96
Alternative Gene Name: AG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087006: 97%, ENSRNOG00000055564: 97%
Entrez Gene ID: 387763
Uniprot ID: Q7Z7L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
• Gene Sequence: RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
• Gene ID - Mouse: ENSMUSG00000087006
• Gene ID - Rat: ENSRNOG00000055564
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.