Anti C11orf54 pAb (ATL-HPA040088)

Atlas Antibodies

Catalog No.: ATL-HPA040088-25

Protein Description: chromosome 11 open reading frame 54
Gene Name: C11orf54
Alternative Gene Name: PTD012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031938: 90%, ENSRNOG00000010887: 93%
Entrez Gene ID: 28970
Uniprot ID: Q9H0W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
• Gene Sequence: MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
• Gene ID - Mouse: ENSMUSG00000031938
• Gene ID - Rat: ENSRNOG00000010887
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.