Anti C10orf76 pAb (ATL-HPA053580)

Atlas Antibodies

Catalog No.: ATL-HPA053580-25

Protein Description: chromosome 10 open reading frame 76
Gene Name: C10orf76
Alternative Gene Name: FLJ13114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039901: 99%, ENSRNOG00000025523: 99%
Entrez Gene ID: 79591
Uniprot ID: Q5T2E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELPLDADVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRVNLHRMPMRHRKKAADKNLPCRP
• Gene Sequence: ELPLDADVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRVNLHRMPMRHRKKAADKNLPCRP
• Gene ID - Mouse: ENSMUSG00000039901
• Gene ID - Rat: ENSRNOG00000025523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.