Anti BTBD7 pAb (ATL-HPA053406)

Atlas Antibodies

Catalog No.: ATL-HPA053406-25

Protein Description: BTB (POZ) domain containing 7
Gene Name: BTBD7
Alternative Gene Name: FLJ10648, FUP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041702: 82%, ENSRNOG00000008598: 87%
Entrez Gene ID: 55727
Uniprot ID: Q9P203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHTHTSRKKHTLEQKTDTRENPQEYPDFYDFSNAACRPSTPALSRRTPSPSQGGYFGPDLYSHNKASPSGLKSAYLPGQTSPKKQEEARREYPLSPDG
• Gene Sequence: RHTHTSRKKHTLEQKTDTRENPQEYPDFYDFSNAACRPSTPALSRRTPSPSQGGYFGPDLYSHNKASPSGLKSAYLPGQTSPKKQEEARREYPLSPDG
• Gene ID - Mouse: ENSMUSG00000041702
• Gene ID - Rat: ENSRNOG00000008598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.