Anti BSCL2 pAb (ATL-HPA042394)

Atlas Antibodies

Catalog No.: ATL-HPA042394-25

Protein Description: Berardinelli-Seip congenital lipodystrophy 2 (seipin)
Gene Name: BSCL2
Alternative Gene Name: GNG3LG, SPG17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071657: 94%, ENSRNOG00000052393: 51%
Entrez Gene ID: 26580
Uniprot ID: Q96G97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTR
• Gene Sequence: PTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTR
• Gene ID - Mouse: ENSMUSG00000071657
• Gene ID - Rat: ENSRNOG00000052393
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.