Anti BRCA1 pAb (ATL-HPA057371 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057371-25

• 

Protein Description: BRCA1, DNA repair associated
Gene Name: BRCA1
Alternative Gene Name: BRCC1, FANCS, PPP1R53, RNF53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017146: 65%, ENSRNOG00000020701: 68%
Entrez Gene ID: 672
Uniprot ID: P38398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA
• Gene Sequence: GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA
• Gene ID - Mouse: ENSMUSG00000017146
• Gene ID - Rat: ENSRNOG00000020701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.