Anti BNIP1 pAb (ATL-HPA008149)

Atlas Antibodies

Catalog No.: ATL-HPA008149-25

Protein Description: BCL2/adenovirus E1B 19kDa interacting protein 1
Gene Name: BNIP1
Alternative Gene Name: Nip1, SEC20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024191: 93%, ENSRNOG00000020753: 94%
Entrez Gene ID: 662
Uniprot ID: Q12981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKL
• Gene Sequence: KQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKL
• Gene ID - Mouse: ENSMUSG00000024191
• Gene ID - Rat: ENSRNOG00000020753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.