Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041698-25

• 
• 
• 

Protein Description: biliverdin reductase B (flavin reductase (NADPH))
Gene Name: BLVRB
Alternative Gene Name: FLR, SDR43U1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040466: 93%, ENSRNOG00000024410: 92%
Entrez Gene ID: 645
Uniprot ID: P30043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
• Gene Sequence: HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
• Gene ID - Mouse: ENSMUSG00000040466
• Gene ID - Rat: ENSRNOG00000024410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BLVRB pAb (ATL-HPA041698 w/enhanced validation) – 2 Found

Matic, Ljubica Perisic; Jesus Iglesias, Maria; Vesterlund, Mattias; Lengquist, Mariette; Hong, Mun-Gwan; Saieed, Shanga; Sanchez-Rivera, Laura; Berg, Martin; Razuvaev, Anton; Kronqvist, Malin; Lund, Kent; Caidahl, Kenneth; Gillgren, Peter; Pontén, Fredrik; Uhlén, Mathias; Schwenk, Jochen M; Hansson, Göran K; Paulsson-Berne, Gabrielle; Fagman, Erika; Roy, Joy; Hultgren, Rebecka; Bergström, Göran; Lehtiö, Janne; Odeberg, Jacob; Hedin, Ulf. Novel Multiomics Profiling of Human Carotid Atherosclerotic Plaques and Plasma Reveals Biliverdin Reductase B as a Marker of Intraplaque Hemorrhage. Jacc. Basic To Translational Science. 2018;3(4):464-480. 

Gao, Zhihui; Ni, Xiaojian; Zheng, Bohao; Sun, Wentao; Wan, Wenze; Liu, Han; Ni, Xiaoling; Suo, Tao; Li, Na; Liu, Houbao; Shen, Sheng. Biliverdin reductase B impairs cholangiocarcinoma cell motility by inhibiting the Notch/Snail signaling pathway. Journal Of Cancer. 13(7):2159-2170.