Anti BICD2 pAb (ATL-HPA024452 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024452-25

Protein Description: bicaudal D homolog 2 (Drosophila)
Gene Name: BICD2
Alternative Gene Name: KIAA0699
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037933: 87%, ENSRNOG00000016031: 88%
Entrez Gene ID: 23299
Uniprot ID: Q8TD16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISE
• Gene Sequence: EQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISE
• Gene ID - Mouse: ENSMUSG00000037933
• Gene ID - Rat: ENSRNOG00000016031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BICD2 pAb (ATL-HPA024452 w/enhanced validation) – 1 Found

Terenzio, Marco; Golding, Matthew; Russell, Matthew R G; Wicher, Krzysztof B; Rosewell, Ian; Spencer-Dene, Bradley; Ish-Horowicz, David; Schiavo, Giampietro. Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors. The Embo Journal. 2014;33(14):1582-98.