Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045212-25

Protein Description: BicC family RNA binding protein 1
Gene Name: BICC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014329: 92%, ENSRNOG00000000614: 94%
Entrez Gene ID: 80114
Uniprot ID: Q9H694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
• Gene Sequence: NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
• Gene ID - Mouse: ENSMUSG00000014329
• Gene ID - Rat: ENSRNOG00000000614
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation) – 1 Found

Sun, Ruohan; Pan, Yujun; Mu, Long; Ma, Yaguang; Shen, Hong; Long, Yu. Development of a 3 RNA Binding Protein Signature for Predicting Prognosis and Treatment Response for Glioblastoma Multiforme. Frontiers In Genetics. 12( 34733320):768930.