Anti BHLHE41 pAb (ATL-HPA056035)

Atlas Antibodies

SKU: ATL-HPA056035-25

• 

Protein Description: basic helix-loop-helix family, member e41
Gene Name: BHLHE41
Alternative Gene Name: BHLHB3, bHLHe41, DEC2, SHARP-1, SHARP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030256: 86%, ENSRNOG00000007152: 45%
Entrez Gene ID: 79365
Uniprot ID: Q9C0J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
• Gene Sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
• Gene ID - Mouse: ENSMUSG00000030256
• Gene ID - Rat: ENSRNOG00000007152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.