Anti BEX5 pAb (ATL-HPA059058 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA059058-25

Protein Description: brain expressed, X-linked 5
Gene Name: BEX5
Alternative Gene Name: NGFRAP1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040850: 32%, ENSRNOG00000060340: 32%
Entrez Gene ID: 340542
Uniprot ID: Q5H9J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDD
• Gene Sequence: NKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDD
• Gene ID - Mouse: ENSMUSG00000040850
• Gene ID - Rat: ENSRNOG00000060340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.