Anti BDH2 pAb (ATL-HPA036028 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036028-25

Protein Description: 3-hydroxybutyrate dehydrogenase, type 2
Gene Name: BDH2
Alternative Gene Name: DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028167: 87%, ENSRNOG00000014490: 83%
Entrez Gene ID: 56898
Uniprot ID: Q9BUT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
• Gene Sequence: CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
• Gene ID - Mouse: ENSMUSG00000028167
• Gene ID - Rat: ENSRNOG00000014490
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BDH2 pAb (ATL-HPA036028 w/enhanced validation) – 1 Found

Cui, Wanmeng; Luo, Wenqi; Zhou, Xiaohui; Lu, Yunliang; Xu, Wenqing; Zhong, Suhua; Feng, Guofei; Liang, Yushan; Liang, Libin; Mo, Yingxi; Xiao, Xue; Huang, Guangwu; Matskova, Liudmila; Zhang, Zhe; Li, Ping; Zhou, Xiaoying. Dysregulation of Ketone Body Metabolism Is Associated With Poor Prognosis for Clear Cell Renal Cell Carcinoma Patients. Frontiers In Oncology. 9( 31921677):1422.