Anti BCO2 pAb (ATL-HPA039825)

Atlas Antibodies

Catalog No.: ATL-HPA039825-25

Protein Description: beta-carotene oxygenase 2
Gene Name: BCO2
Alternative Gene Name: B-DIOX-II, BCDO2, FLJ34464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032066: 47%, ENSRNOG00000038746: 48%
Entrez Gene ID: 83875
Uniprot ID: Q9BYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
• Gene Sequence: VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
• Gene ID - Mouse: ENSMUSG00000032066
• Gene ID - Rat: ENSRNOG00000038746
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.