Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA067881-25

Protein Description: breast carcinoma amplified sequence 2
Gene Name: BCAS2
Alternative Gene Name: DAM1, Snt309, SPF27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005687: 100%, ENSRNOG00000018783: 100%
Entrez Gene ID: 10286
Uniprot ID: O75934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS
• Gene Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS
• Gene ID - Mouse: ENSMUSG00000005687
• Gene ID - Rat: ENSRNOG00000018783
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.