Anti BAD pAb (ATL-HPA028185)

Atlas Antibodies

SKU: ATL-HPA028185-25

• 
• 

Protein Description: BCL2-associated agonist of cell death
Gene Name: BAD
Alternative Gene Name: BBC2, BCL2L8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024959: 59%, ENSRNOG00000021147: 57%
Entrez Gene ID: 572
Uniprot ID: Q92934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
• Gene Sequence: QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
• Gene ID - Mouse: ENSMUSG00000024959
• Gene ID - Rat: ENSRNOG00000021147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.