Anti BABAM1 pAb (ATL-HPA054386)

Atlas Antibodies

Catalog No.: ATL-HPA054386-100

Protein Description: BRISC and BRCA1 A complex member 1
Gene Name: BABAM1
Alternative Gene Name: C19orf62, FLJ20571, HSPC142, MERIT40, NBA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031820: 80%, ENSRNOG00000017071: 80%
Entrez Gene ID: 29086
Uniprot ID: Q9NWV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
• Gene Sequence: EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
• Gene ID - Mouse: ENSMUSG00000031820
• Gene ID - Rat: ENSRNOG00000017071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.