Anti ATP9A pAb (ATL-HPA035630 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035630-100

Protein Description: ATPase, class II, type 9A
Gene Name: ATP9A
Alternative Gene Name: ATPIIA, KIAA0611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027546: 91%, ENSRNOG00000014243: 39%
Entrez Gene ID: 10079
Uniprot ID: O75110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG
• Gene Sequence: MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG
• Gene ID - Mouse: ENSMUSG00000027546
• Gene ID - Rat: ENSRNOG00000014243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.