Anti ATP6V0A2 pAb (ATL-HPA044279)

Atlas Antibodies

SKU: ATL-HPA044279-25

• 

Protein Description: ATPase, H+ transporting, lysosomal V0 subunit a2
Gene Name: ATP6V0A2
Alternative Gene Name: a2, ATP6a2, ATP6N1D, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038023: 94%, ENSRNOG00000052704: 95%
Entrez Gene ID: 23545
Uniprot ID: Q9Y487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE
• Gene Sequence: EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE
• Gene ID - Mouse: ENSMUSG00000038023
• Gene ID - Rat: ENSRNOG00000052704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.