Anti ATP5H pAb (ATL-HPA042777 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042777-25

• 
• 

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d
Gene Name: ATP5H
Alternative Gene Name: ATP5JD, ATPQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034566: 84%, ENSRNOG00000003626: 80%
Entrez Gene ID: 10476
Uniprot ID: O75947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
• Gene Sequence: ALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
• Gene ID - Mouse: ENSMUSG00000034566
• Gene ID - Rat: ENSRNOG00000003626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.