Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045400-25

Protein Description: ATPase, H+/K+ exchanging, beta polypeptide
Gene Name: ATP4B
Alternative Gene Name: ATP6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031449: 83%, ENSRNOG00000018543: 80%
Entrez Gene ID: 496
Uniprot ID: P51164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
• Gene Sequence: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
• Gene ID - Mouse: ENSMUSG00000031449
• Gene ID - Rat: ENSRNOG00000018543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.