Anti ATP2B1 pAb (ATL-HPA012945 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012945-100

Protein Description: ATPase, Ca++ transporting, plasma membrane 1
Gene Name: ATP2B1
Alternative Gene Name: PMCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019943: 99%, ENSRNOG00000004026: 100%
Entrez Gene ID: 490
Uniprot ID: P20020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP
• Gene Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP
• Gene ID - Mouse: ENSMUSG00000019943
• Gene ID - Rat: ENSRNOG00000004026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.