Anti ATP23 pAb (ATL-HPA043204)

Atlas Antibodies

Catalog No.: ATL-HPA043204-25

Protein Description: ATP23 metallopeptidase and ATP synthase assembly factor homolog
Gene Name: ATP23
Alternative Gene Name: KUB3, XRCC6BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025436: 68%, ENSRNOG00000045629: 69%
Entrez Gene ID: 91419
Uniprot ID: Q9Y6H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTCNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHF
• Gene Sequence: EQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTCNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHF
• Gene ID - Mouse: ENSMUSG00000025436
• Gene ID - Rat: ENSRNOG00000045629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.