Anti ATOH8 pAb (ATL-HPA028406)

Atlas Antibodies

SKU: ATL-HPA028406-25

• 

Protein Description: atonal bHLH transcription factor 8
Gene Name: ATOH8
Alternative Gene Name: bHLHa21, FLJ14708, HATH6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037621: 73%, ENSRNOG00000010716: 72%
Entrez Gene ID: 84913
Uniprot ID: Q96SQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR
• Gene Sequence: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR
• Gene ID - Mouse: ENSMUSG00000037621
• Gene ID - Rat: ENSRNOG00000010716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.